PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001858G0120
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family HSF
Protein Properties Length: 78aa    MW: 8804.86 Da    PI: 4.8596
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001858G0120genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind86.73.2e-271274264
                     HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE CS
     HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkk 64
                     Fl+k+y++++d++++ ++sws+ +nsfvv+d++ fa+ +Lp+yFkh+nf+SFvRQLn+Y+ ++
  PH01001858G0120 12 FLTKTYDMVDDPTTDGIVSWSAMNNSFVVWDPHAFATVLLPRYFKHNNFSSFVRQLNTYEHSE 74
                     9**********************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.105.6E-29674IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467853.13E-25875IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004152.4E-24874IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004475.5E-231274IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.5E-171235IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.5E-175062IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.5E-176375IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
MEGLHDAGPP PFLTKTYDMV DDPTTDGIVS WSAMNNSFVV WDPHAFATVL LPRYFKHNNF  60
SSFVRQLNTY EHSEIPC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5v_D6e-207752192Heat shock factor protein 1
5d5v_B6e-207752192Heat shock factor protein 1
5d5u_B6e-207752192Heat shock factor protein 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF2085443e-64KF208544.1 Triticum aestivum heat shock factor A2b (HsfA2b) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004981438.21e-42PREDICTED: heat stress transcription factor A-2e-like
SwissprotQ6VBB21e-42HFA2B_ORYSJ; Heat stress transcription factor A-2b
TrEMBLK4AC791e-42K4AC79_SETIT; Uncharacterized protein
STRINGSi036486m4e-42(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP30837231
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22830.13e-38heat shock transcription factor A6B